Save and load data from disk¶
AbPyTools uses its own custom object serialisation to save objects.
- FASTA
The simplest and most used format to save primary sequence data is the FASTA format. Because it is so simple, it easy to parse and work with. Here is an example of a FASTA file:
>seq0
FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF
>seq1
KYRTWEEFTRAAEKLYQADPMKVRVVLKYRHCDGNLCIKVTDDVVCLLYRTDQAQDVKKIEKFHSQLMRLME LKVTDNKECLKFKTDQAQEAKKMEKLNNIFFTLM
The sequence identifier is preceded by a “>” and the following line has the sequence. This could be any sequence, such as DNA or protein, and is usually easy to distinguish due to the different alphabets used to represent these.
The information that can be stored in a FASTA file is very limited, and more sophisticated representations, such as sequence numbering of antibodies are not possible.
- JSON (JavaScript Object Notation)
`JSON<https://www.json.org/>`_ is a lightweight data-interchange format. It resembles a Python dictionary, and is easy to parse and read. However, it is inefficient in terms of disk usage. AbPyTools uses this format to serialise objects, and the resulting files are human readable.
{
"ordered_names": ["test"],
"test": {
"numbering": [
H1,
H2,
...
]
"numbering_scheme": "chothia",
...
}
- Protocol Buffers
Protocol Buffers are relatively straight forward to use. They
encode messages in binary format, with a focus on speed
of encoding/decoding and disk usage reduction. In AbPyTools, this format is about
5 times more space efficient and at least as fast to read and write,
compared to JSON. The downside is that it is not human readable and
requires the precompiled parser to perform the encoding and decoding.
The message structure is defined in .proto files which can be found
in abpytools/core/formats.